PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590398.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 250aa    MW: 28733.1 Da    PI: 9.1644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590398.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.6e-092569345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      WT+eE +++  a + +  +   +W ++a  ++ g+t +++   + 
   XP_009590398.1 25 EWTQEENKKFESALAIYDERtpnRWFKVADLIP-GKTVYDVMKQYK 69
                     7********************************.*******98876 PP

2Myb_DNA-binding40.94.8e-13120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_009590398.1 120 PWTEEEHRRFLMGLDKHGKGDWRNISRNFVISKTPTQVASHAQKY 164
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-41770IPR009057Homeodomain-like
PROSITE profilePS512937.9252176IPR017884SANT domain
SMARTSM007172.4E-92274IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-112476IPR009057Homeodomain-like
PfamPF002499.0E-72569IPR001005SANT/Myb domain
CDDcd001671.85E-72571No hitNo description
PROSITE profilePS5129419.38113169IPR017930Myb domain
SuperFamilySSF466892.73E-16114168IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17116168IPR006447Myb domain, plants
SMARTSM007178.4E-11117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-11117164IPR009057Homeodomain-like
CDDcd001672.07E-8120164No hitNo description
PfamPF002493.3E-11120164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
METLWATSLI PNSSWMMMEQ RKSSEWTQEE NKKFESALAI YDERTPNRWF KVADLIPGKT  60
VYDVMKQYKE LAADVSDIEA GLFPVPPSSF MLELVDDNRG VQAFRKRGRS FDQERKKGVP  120
WTEEEHRRFL MGLDKHGKGD WRNISRNFVI SKTPTQVASH AQKYYLRQLS GGKDKRRPSI  180
HDITTVNLTN IDLSDNNLNS NNNNNNNKFP SSFAVNNPLQ NSNDGALMAF GSSYNSSSYP  240
YEFGSVNIWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104116RKRGRSFDQERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590398.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016455127.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-81DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1BUZ61e-103M1BUZ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000534331e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.11e-80MYB family protein